Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVER SSKGTRASVKEQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDE FSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMTKVQAELDETK IILHNTMESLLERGEKLDDLVSKSEVLGTLSKAFYKTARKQNSCCAIM
    • Amino acids
      1 to 198
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • R SNARE
    • SNARE protein Ykt6
    • Synaptobrevin homolog YKT6
    • YKT 6
    • YKT6
    • YKT6 S. cerevisiae homolog of
    • YKT6 v SNARE homolog
    • YKT6 v SNARE protein
    • YKT6_HUMAN
    see all
  • Function
    Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.
  • Sequence similarities
    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Domain
    The longin domain regulates palmitoylation and membrane targeting.
  • Post-translational
    modifications
    Palmitoylated; catalyzes its own palmitoylation. Palmitoylation is required for Golgi targeting.
    Farnesylation is required for Golgi targeting.
  • Cellular localization
    Cytoplasm > cytosol. Cytoplasmic vesicle membrane. Golgi apparatus membrane. Probably cycles through vesicles between Golgi and endosomes.
  • Information by UniProt

Images

  • ab161094 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161094 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up