Recombinant Human YTHDF2 protein (ab153351)

Overview

  • Product name
    Recombinant Human YTHDF2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTA MSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFL PDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYS SNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVA SNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQ PKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTR WVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNP KDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMN GKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWI FVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHT TSIFDDFSHYEKRQEEEESVKKERQGRGK
    • Amino acids
      1 to 579
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9430020E02Rik
    • CAHL
    • CLL associated antigen KW 14
    • CLL-associated antigen KW-14
    • HGRG8
    • High glucose regulated protein 8
    • High-glucose-regulated protein 8
    • NY REN 2
    • Renal carcinoma antigen NY REN 2
    • Renal carcinoma antigen NY-REN-2
    • YTH domain family 2
    • YTH domain family member 2
    • YTH domain family protein 2
    • YTH N6 methyladenosine RNA binding protein 2
    • YTHD2_HUMAN
    • YTHDF 2
    • YTHDF2
    see all
  • Sequence similarities
    Contains 1 YTH domain.
  • Information by UniProt

Images

  • ab153351 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up