Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDL SDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      221 to 320

Specifications

Our Abpromise guarantee covers the use of ab112373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112373 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CF1
    • Delta
    • Delta transcription factor
    • INO80 complex subunit S
    • INO80S
    • NF E1
    • NF-E1
    • NFE1
    • OTTHUMP00000197459
    • Transcriptional repressor protein YY1
    • TYY1_HUMAN
    • UCR motif DNA binding protein
    • UCRBP
    • Yin and yang 1
    • Yin and Yang 1 protein
    • Yin Yang 1
    • Ying Yang 1
    • YY 1
    • YY 1 transcription factor
    • YY-1
    • YY1
    • YY1 transcription factor
    see all
  • Function
    Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. May play an important role in development and differentiation. The function of YY1 as an activator or a repressor is specified by the presence of other proteins. For example it acts as a repressor in absence of adenovirus E1A protein but as an activator in its presence.
  • Sequence similarities
    Belongs to the YY transcription factor family.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus matrix. Associated with the nuclear matrix.
  • Information by UniProt

Recombinant Human YY1 protein images

  • ab112373 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human YY1 protein (ab112373)

ab112373 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up