Overview

  • Product name
    Recombinant Human ZAN protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASG PSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQG
    • Amino acids
      19 to 113
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000211358
    • OTTHUMP00000211359
    • OTTHUMP00000211360
    • OTTHUMP00000211361
    • OTTHUMP00000211362
    • OTTHUMP00000211363
    • ZAN
    • ZAN_HUMAN
    • Zonadhesin
    see all
  • Function
    Binds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.
  • Tissue specificity
    In testis, primarily in haploid spermatids.
  • Sequence similarities
    Contains 1 EGF-like domain.
    Contains 3 MAM domains.
    Contains 4 TIL (trypsin inhibitory-like) domains.
    Contains 5 VWFC domains.
    Contains 4 VWFD domains.
  • Domain
    The MAM domains probably mediate sperm adhesion to the zona pellucida.
    During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.
    The VWFD domain 2 may mediate covalent oligomerization.
  • Cellular localization
    Cell membrane. Exclusively on the apical region of the sperm head.
  • Information by UniProt

Images

  • ab159808 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up