Recombinant Human ZBTB20 protein (ab161906)

Overview

  • Product name
    Recombinant Human ZBTB20 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQG EKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
    • Amino acids
      451 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dendritic derived BTB/POZ zinc finger protein
    • Dendritic-derived BTB/POZ zinc finger protein
    • DKFZp566F123
    • DPZF
    • HOF
    • ODA 8S
    • OTTHUMP00000215066
    • OTTHUMP00000215067
    • OTTHUMP00000215069
    • OTTHUMP00000215071
    • ZBT20_HUMAN
    • Zbtb20
    • zinc finger 288
    • zinc finger and BTB domain containing 20
    • Zinc finger and BTB domain-containing protein 20
    • Zinc finger protein 288
    • ZNF288
    see all
  • Function
    May be a transcription factor that may be involved in hematopoiesis, oncogenesis, and immune responses.
  • Tissue specificity
    Expressed in spleen, lymph node, thymus, peripheral blood leukocytes, and fetal liver.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161906 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up