Recombinant Human ZC3H15 protein (ab163255)

Overview

  • Product name
    Recombinant Human ZC3H15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQV KFGQQNPRQVAQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADP KSVVCAFFKQGQCTKGDKCKFSHDLTLERKCEKRSVYIDARDEELEKDTM DNWDEKKLEEVVNKKHGEAEKKKPKTQIVCKHFLEAIENNKYGWFWVCPG GGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKI TLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE LVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVA SLERFSTYTSDKDENKLSEASGGRAENGERSDLEEDNEREGTENGAIDAV PVDENLFTGEDLDELEEELNTLDLEE
    • Amino acids
      1 to 426
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DFRP1
    • DRG family-regulatory protein 1
    • HT010
    • LEREPO4
    • Likely ortholog of mouse immediate early response erythropoietin 4
    • MSTP012
    • ZC3H15
    • ZC3HF_HUMAN
    • Zinc finger CCCH domain-containing protein 15
    • Zinc finger CCCH-type containing 15
    see all
  • Function
    Protects DRG1 from proteolytic degradation.
  • Sequence similarities
    Belongs to the ZC3H15/TMA46 family.
    Contains 2 C3H1-type zinc fingers.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163255 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up