Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADEQEIMCKLESIKEIRNKTLQMEKIKAR LKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIHADINVMENTI KQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKL SLDYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFR QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 224
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 3.4% Imidazole
    Constituents: 0.24% Tris, 1.46% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • HCA127
    • Hepatocellular carcinoma-associated antigen 127
    • KIAA1166
    • OTTHUMP00000023432
    • Zc4h2
    • ZC4H2_HUMAN
    • Zinc finger C4H2 domain containing
    • Zinc finger C4H2 domain-containing protein
    see all
  • Sequence similarities
    Contains 1 C4H2-type zinc finger.
  • Information by UniProt

References

ab172815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up