Recombinant Human ZCCHC17 protein (ab104634)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NP64
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVT DYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK NDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEA VLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPD PTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAK KKKKKKKHKKKHKE
    • Molecular weight30 kDa including tags
    • Amino acids1 to 241
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104634 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • 2810055E05Rik
    • HSPC251
    • LDC4
    • NO40_HUMAN
    • Nucleolar protein 40
    • Nucleolar protein of 40 kDa
    • OTTHUMP00000003890
    • OTTHUMP00000003891
    • Pnn-interacting nucleolar protein
    • pNO40
    • pS1D
    • PS1D protein
    • Putative S1 RNA binding domain protein
    • Putative S1 RNA-binding domain protein
    • RGD1565267
    • ZCCHC17
    • Zinc finger CCHC domain-containing protein 17
    • Zinc finger, CCHC domain containing 17
    see all
  • Sequence similaritiesContains 1 CCHC-type zinc finger.
    Contains 1 S1 motif domain.
  • Cellular localizationNucleus, nucleolus.
  • Information by UniProt

Recombinant Human ZCCHC17 protein images

  • 15% SDS-PAGE showing ab104634 (3 µg).
    Note: Molecular weight on SDS-PAGE will appear higher than the predicted molecular weight of approximately 30 kDa.

References for Recombinant Human ZCCHC17 protein (ab104634)

ab104634 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"