Recombinant Human ZDHHC11 protein (ab164134)

Overview

  • Product name
    Recombinant Human ZDHHC11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDTRSGSQCSVTPEAILNNEKLVLPPRISRVNGWSLPLHYFQVVTWAVFV GLSSATFGIFIPFLPHAWKYIAYVVTGGIFSFHLVVHLIASCIDPADSNV RLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVNKKTKHCISCNKCVSG FDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPG VLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLVLLLDFLGLVH LGQLLIFHIYLKAKKMTTFEYLINNRKEESSKHQAVRKDPYVQMDKGVLQ QGAGALGSSAQGVKAKSSLLIHKHLCHFCTSVNQDGDSTAREGDEDPCPS ALGAKARNSRLICRRLCQFSTRVHPDGGSMAQEADDAPSISTLGLQQETT EPMKTDSAESED
    • Amino acids
      1 to 412
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4933421L13Rik
    • DHHC 11
    • DHHC-11
    • FLJ13153
    • MGC151180
    • MGC151184
    • OTTHUMP00000115368
    • Probable palmitoyltransferase ZDHHC11
    • ZDH11_HUMAN
    • ZDHHC 11
    • ZDHHC11
    • Zdhhc20
    • zinc finger DHHC domain containing 11
    • Zinc finger DHHC domain containing protein 11
    • Zinc finger DHHC domain-containing protein 11
    • Zinc finger DHHC type containing 11
    • Zinc finger protein 399
    • ZNF 399
    • ZNF399
    see all
  • Sequence similarities
    Belongs to the DHHC palmitoyltransferase family.
    Contains 1 DHHC-type zinc finger.
  • Domain
    The DHHC domain is required for palmitoyltransferase activity.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164134 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up