Recombinant Human ZDHHC13 protein (ab162758)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSN CDIVKATQYGIFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVKF YISKGAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLIDGEGF SSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTG FLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKG ETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSV ITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTA FLLSSVFWIFMTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPG FTKASEEEKKVNIITLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNCCVA RYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSFIYLSSHCATT FKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLNQLFQIAFLGL TSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCV VDWTSQYTMVFHPAREKVLRSV
    • Amino acids
      1 to 622
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DHHC 13
    • DHHC-13
    • FLJ10852
    • FLJ10941
    • HIP14 like
    • HIP14 related protein
    • HIP14-related protein
    • HIP14L
    • HIP3RP
    • Huntingtin interacting protein 14 related protein
    • Huntingtin interacting protein HIP3RP
    • Huntingtin-interacting protein 14-related protein
    • Huntingtin-interacting protein HIP3RP
    • Hypothetical protein similar to ankyrin repeat containing priotein AKR1
    • MGC64994
    • Palmitoyltransferase ZDHHC13
    • Probable palmitoyltransferase ZDHHC13
    • Putative MAPK activating protein PM03
    • Putative MAPK-activating protein PM03
    • Putative NF kappa B activating protein 209
    • Putative NF-kappa-B-activating protein 209
    • ZDH13_HUMAN
    • ZDHHC 13
    • ZDHHC13
    • Zinc finger DHHC domain containing 13
    • Zinc finger DHHC domain-containing protein 13
    see all
  • Function
    Palmitoyltransferase for HD and GAD2 (By similarity). Mediates Mg(2+) transport.
  • Sequence similarities
    Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
    Contains 6 ANK repeats.
    Contains 1 DHHC-type zinc finger.
  • Domain
    The DHHC domain is required for palmitoyltransferase activity.
  • Cellular localization
    Golgi apparatus membrane. Cytoplasmic vesicle membrane. Low extracellular Mg(2+) induces increase in Golgi and in post-Golgi vesicles.
  • Information by UniProt

Images

  • ab162758 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up