Overview

  • Product name
    Recombinant Human ZEB1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVS PAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      801 to 900

Specifications

Our Abpromise guarantee covers the use of ab152728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AREB 6
    • AREB6
    • BZP
    • Delta crystallin enhancer binding factor 1
    • DELTA EF1
    • FECD6
    • MGC133261
    • Negative regulator of IL 2
    • Negative regulator of IL2
    • NIL 2 A
    • NIL 2 A zinc finger protein
    • NIL 2A
    • NIL-2-A zinc finger protein
    • NIL2A
    • Posterior polymorphous corneal dystrophy 3
    • PPCD3
    • Represses interleukin 2 expression
    • TCF 8
    • TCF-8
    • TCF8
    • Transcription factor 8
    • Transcription factor 8 (represses interleukin 2 expression)
    • ZEB
    • ZEB 1
    • ZEB1
    • ZEB1_HUMAN
    • ZFHEP
    • ZFHX 1A
    • ZFHX1A
    • Zinc finger E box binding homeobox 1
    • Zinc finger E-box-binding homeobox 1
    • Zinc finger homeodomain enhancer binding protein
    see all
  • Function
    Inhibits interleukin-2 (IL-2) gene expression. May be responsible for transcriptional repression of the IL-2 gene. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
  • Tissue specificity
    Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed in heart and skeletal muscle, but not in liver, spleen, or pancreas.
  • Involvement in disease
    Defects in ZEB1 are the cause of posterior polymorphous corneal dystrophy type 3 (PPCD3) [MIM:609141]. PPCD is a rare disease involving metaplasia and overgrowth of corneal endothelial cells. In patients with PPCD, these cells manifest in an epithelial morphology and gene expression pattern, produce an aberrant basement membrane, and, sometimes, spread over the iris and nearby structures in a way that increases the risk for glaucoma.
    Defects in ZEB1 are the cause of corneal dystrophy Fuchs endothelial type 6 (FECD6) [MIM:613270]. It is an ocular disorder caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition.
  • Sequence similarities
    Belongs to the delta-EF1/ZFH-1 C2H2-type zinc-finger family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152728 stained with Coomassie Blue.

References

ab152728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up