Overview

  • Product name
    Recombinant Human ZFP64 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK QSGCQLTGTSAAAPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPE FVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPG CQFKTAYGMKDMERHLKIHTGDKPHKCEVCGKCFSRKDKLKTHMRCHTGV KPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNSSQLTVHL RSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCEFCNVRCTMKG NLKSHIRIKHSGNNFKCPHCDFLGDSKATLRKHSRVHQSEHPEKCSECSY SCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMVKT EALERKDTGRQSSRQVAKLDAKKSFHCDICDASFMREDSLRSHKRQHSEY NESKNSDVTVLQFQIDPSKQPATPLTVGHLQVPLQPSQVPQFSEGRVKII VGHQVPQANTIVQAAAAAVNIVPPALVAQNPEELPGNSRLQILRQVSLIA PPQSSRCPSEAGAMTQPAVLLTTHEQTDGATLHQTLIPTASGGPQEGSGN QTFITSSGITCTDFEGLNALIQEGTAEVTVVSDGGQNIAVATTAPPVFSS SSQQELPKQTYSIIQGAAHPALLCPADSIPD
    • Amino acids
      1 to 681
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ548G19.1
    • dJ831D17.1
    • FLJ10734
    • FLJ12628
    • MGC940
    • ZFP64 zinc finger protein
    • Zinc finger protein 338
    • Zinc finger protein 64
    • Zinc finger protein 64 homolog
    • Zinc finger protein 64 isoforms 1 and 2
    • Zinc finger protein 64 isoforms 3 and 4
    • ZNF338
    see all
  • Relevance
    ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.
  • Cellular localization
    Nuclear

Images

  • ab163193 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up