Recombinant Human Zhangfei protein (ab163675)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS ACARKASSSLKM
    • Amino acids
      211 to 272
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110034C16Rik
    • 6330417B10Rik
    • AI225749
    • AI606244
    • CREB/ATF bZIP transcription factor
    • Crebzf
    • FLJ94018
    • HCF-binding transcription factor Zhangfei
    • Host cell factor-binding transcription factor Zhangfei
    • LAZip
    • LAZipII
    • SHP-interacting leucine zipper protein
    • SMILE
    • ZF
    • ZHANG_HUMAN
    see all
  • Function
    Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
  • Tissue specificity
    In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.
  • Sequence similarities
    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus. Colocalizes at punctate nuclear structures with CREB3 and HCFC1.
  • Information by UniProt

Images

  • ab163675 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up