Overview

  • Product name
    Recombinant Human ZHX2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEE DLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEES
    • Amino acids
      691 to 788
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AFP regulator 1
    • AFR1
    • Alpha fetoprotein regulator 1
    • Alpha-fetoprotein regulator 1
    • KIAA0854
    • RAF
    • Regulator of AFP
    • Transcription factor ZHX2
    • ZHX2
    • ZHX2_HUMAN
    • Zinc finger and homeodomain protein 2
    • Zinc fingers and homeoboxes 2
    • Zinc fingers and homeoboxes protein 2
    see all
  • Function
    Acts as a transcriptional repressor.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the ZHX family.
    Contains 2 C2H2-type zinc fingers.
    Contains 4 homeobox DNA-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153195 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up