Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15915
    • SpeciesHuman
    • SequenceLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNP SSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
    • Molecular weight36 kDa including tags
    • Amino acids2 to 95

Specifications

Our Abpromise guarantee covers the use of ab112375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesab112375 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Odd paired homolog Drosophila
    • ZIC
    • Zic 1
    • Zic family member 1
    • Zic family member 1 (odd-paired Drosophila homolog)
    • Zic protein member 1
    • zic1
    • ZIC1_HUMAN
    • Zinc finger protein 201
    • Zinc finger protein of the cerebellum 1
    • Zinc finger protein ZIC 1
    • Zinc finger protein ZIC1
    • ZNF 201
    • ZNF201
    see all
  • FunctionActs as a transcriptional activator. Involved in neurogenesis. Plays important roles in the early stage of organogenesis of the CNS, as well as during dorsal spinal cord development and maturation of the cerebellum. Involved in the spatial distribution of mossy fiber (MF) neurons within the pontine gray nucleus (PGN). Plays a role in the regulation of MF axon pathway choice. Promotes MF migration towards ipsilaterally-located cerebellar territories. May have a role in shear flow mechanotransduction in osteocytes. Retains nuclear GLI1 and GLI3 in the cytoplasm. Binds to the minimal GLI-consensus sequence 5'-TGGGTGGTC-3'.
  • Tissue specificityCNS. A high level expression is seen in the cerebellum. Detected in the nuclei of the cerebellar granule cell lineage from the progenitor cells of the external germinal layer to the postmigrated cells of the internal granular layer. Detected in medulloblastoma (26/29 cases), but not present in all other tumors examined.
  • Sequence similaritiesBelongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • DomainThe C2H2-type 3, 4 and 5 zinc finger domains are necessary for transcription activation.
  • Cellular localizationNucleus. Cytoplasm. Localizes in the cytoplasm in presence of MDFIC overexpression.
  • Information by UniProt

Recombinant Human Zic1 protein images

  • ab112375 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Zic1 protein (ab112375)

ab112375 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"