Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGSMAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYF SQDEWGLLDEAQRLL YLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQS CEMCVPVLKDILHLA DLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKP FRKWEVGKDLPAMLR LLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPR VYTGKKLYECSKCGK AFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYE CSECGKLFRQNSSLV DHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFS QSAILNQHRRIHTGA KPYECGQC
    • Molecular weight
      45 kDa including tags
    • Amino acids
      1 to 384

Specifications

Our Abpromise guarantee covers the use of ab172813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituent: 0.24% Tris

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • ZIK1
    • ZIK1_HUMAN
    • Zinc finger protein 762
    • Zinc finger protein interacting with K protein 1
    • Zinc finger protein interacting with ribonucleoprotein K
    see all
  • Function
    May be a transcriptional repressor.
  • Tissue specificity
    Expressed at high levels in gastric glands, and at low levels in colon and small intestine. Silenced through promoter methylation in gastric glands with intestinal metaplasia.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab172813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up