Recombinant Human Zinc Alpha 2 Glycoprotein (ab152223)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL GSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMET LKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDGKDYIEFNKE IPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNI LDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPEL RGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab152223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha 2 glycoprotein 1 zinc
    • Alpha 2 glycoprotein 1 zinc binding
    • Alpha 2 glycoprotein zinc
    • Azgp1
    • ZA2G
    • ZA2G_HUMAN
    • ZAG
    • Zinc alpha 2 glycoprotein precursor
    • Zinc-alpha-2-glycoprotein
    • Zn alpha 2 glycoprotein
    • Zn alpha 2 GP
    • Zn alpha2 glycoprotein
    • Zn-alpha-2-glycoprotein
    • Zn-alpha-2-GP
    • ZNGP1
    see all
  • Function
    Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. May bind polyunsaturated fatty acids.
  • Tissue specificity
    Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.
  • Sequence similarities
    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152223 stained with Coomassie Blue.

References

ab152223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up