Recombinant Human Zinc finger protein 709 (ab165753)

Overview

  • Product name
    Recombinant Human Zinc finger protein 709
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEK NIEDHKNQGRKLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVK PYECSVCGKDYMCHSSLNRHMRSHTEHRSYEYHKYGEKSYECKECGKRFS FRSSFRIHERTHTGEKPYKCKQCGKAFSWPSSFQIHERTHTGEKPYECKE CGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEK PYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHER IHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPS YRRHMIMHTGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKA FSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEKPYEC KQCGKAFSCSSSFRMHERIHTGEKPYECKQCGKAFSFSSSFRMHERTHTG EKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAFSCSSSIRIH ERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFSCS RSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
    • Amino acids
      1 to 641
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9530015I07Rik
    • mCG_22830
    • Zinc finger protein 709
    • zinc finger protein 872
    • ZN709_HUMAN
    • ZNF709
    see all
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 19 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165753 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up