Recombinant Human ZKSCAN1 protein (ab159841)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMTAESREATGLSPQAAQEKDGIVIAKVEEEDEEDHMWGQDSTLQDTPPP DPEIFRQRFRRFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLV LEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQVPGQVHGP EMLARGMVPLDPVQESSSFDLHHEATQSHFKHSSRKPRLLQSRALPAAHI PAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRN LSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKE FGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREK GKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHT GEKPYECSECGKAFSLNSNLVLHQRIHTGEKPHECNECGKAFSHSSNLIL HQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNR NSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERASEYSPA SLDAFGAFLKSCV
    • Amino acids
      1 to 563
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9130423L19Rik
    • KOX18
    • MGC138429
    • MGC63357
    • OTTHUMP00000210080
    • PHZ 37
    • PHZ-37
    • Zinc finger protein 139
    • Zinc finger protein 36
    • Zinc finger protein 36 (KOX 18)
    • Zinc finger protein KOX18
    • Zinc finger protein with KRAB and SCAN domains 1
    • ZKSC1_HUMAN
    • ZKSCAN1
    • ZNF139
    • ZNF36
    see all
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
    Contains 1 SCAN box domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159841 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up