Overview

  • Product name
    Recombinant Human ZMYM2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDME NEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFP
    • Amino acids
      971 to 1069
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FIM
    • Fused in myeloproliferative disorders protein
    • MYM
    • RAMP
    • Rearranged in an atypical myeloproliferative disorder
    • Rearranged in atypical myeloproliferative disorder protein
    • SCLL
    • ZFP 198
    • Zinc finger MYM type containing 2
    • Zinc finger MYM type protein 2
    • Zinc finger MYM-type protein 2
    • Zinc finger protein 198
    • Zinc finger protein198
    • zinc finger, MYM-type 2
    • ZMYM 2
    • ZMYM2
    • ZMYM2_HUMAN
    • ZNF 198
    • ZNF198
    see all
  • Function
    May function as a transcription factor.
  • Involvement in disease
    Note=A chromosomal aberration involving ZMYM2 may be a cause of stem cell leukemia lymphoma syndrome (SCLL). Translocation t(8;13)(p11;q12) with FGFR1. SCLL usually presents as lymphoblastic lymphoma in association with a myeloproliferative disorder, often accompanied by pronounced peripheral eosinophilia and/or prominent eosinophilic infiltrates in the affected bone marrow.
  • Sequence similarities
    Contains 9 MYM-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159876 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up