Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDF EGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTR QMRSADEGQTVFYTCTNCKFQEKEDS
    • Amino acids
      1 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA directed RNA polymerase I subunit RPA12
    • DNA-directed RNA polymerase I subunit RPA12
    • HTEX 6
    • hZR14
    • RNA polymerase I small specific subunit Rpa12
    • RPA12
    • RPA12_HUMAN
    • tctex 6
    • TCTEX6
    • TEX6
    • Transcription associated zinc ribbon protein
    • Zinc ribbon domain containing 1
    • Zinc ribbon domain containing protein 1
    • Zinc ribbon domain-containing protein 1
    • ZNRD1
    • ZR14
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
  • Sequence similarities
    Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab162325 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up