Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDDPRYGMCPLKGASGCPGAERSLLVQSYFEKGPLTFRDVAIEFSLEEWQ CLDSAQQGLYRKVMLENYRNLVFLAGIALTKPDLITCLEQGKEPWNIKRH EMVAKPPVI
    • Molecular weight
      12 kDa
    • Amino acids
      1 to 109
    • Tags
      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab152046 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Preservative: 3.4% Imidazole
    Constituents: 0.001% Zinc chloride, 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • FLJ44587
    • Zinc finger protein 100
    • zinc finger protein 100 (Y1)
  • Relevance
    ZNF100 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 may be involved in transcriptional regulation.
  • Cellular localization
    Nuclear

References

ab152046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up