Recombinant Human ZNF143 protein (ab159867)

Overview

  • Product name
    Recombinant Human ZNF143 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGSTAY IQHNSKDAKLIDGQVIQLEDGSAAYVQHVPIPKSTGDSLRLEDGQAVQLE DGTTAFIHHTSKDSYDQSALQAVQLEDGTTAYIHHAVQVPQSDTILAIQA DGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQEK KMQIVLQGHATRVTAKSQQSGEKAFRCEYDGCGKLYTTAHHLKVHERSHT GDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSG DLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEP GCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHT HSKPYNCNHCGKTYKQISTLVMHKRTAHNDTEPIEEEQEAFFEPPPGQGE DVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNIS QADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQ VAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQL GEQPSLEEAIRIASRIQQGETPGLDD
    • Amino acids
      1 to 626
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC66276
    • mStaf
    • pHZ 1
    • SBF
    • Selenocysteine tRNA gene transcription activating factor
    • SPH binding factor
    • STAF
    • Zfp143
    • zgc:66276
    • Zinc finger protein 143
    see all
  • Relevance
    ZNF143 is a human homolog of Xenopus transcriptional activator staf that is involved in selenocystyl tRNA transcription which binds to the SPH motif of small nuclear RNA (snRNA) gene promoters.
  • Cellular localization
    Nuclear

Images

  • ab159867 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up