Recombinant Human ZNF197 protein (ab160857)

Overview

  • Product name
    Recombinant Human ZNF197 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLT AQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLGYRK YRRQRNK
    • Amino acids
      161 to 267
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D3S1363E
    • OTTHUMP00000164119
    • P18
    • VHL associated KRAB A domain containing protein
    • VHLaK
    • Zinc finger protein 166
    • Zinc finger protein 197
    • Zinc finger protein 20
    • Zinc finger protein with KRAB and SCAN domains 9
    • ZKSCAN9
    • ZNF166
    • ZNF20
    see all
  • Relevance
    ZNF197 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. ZNF197 contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box.
  • Cellular localization
    Nuclear

Images

  • ab160857 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up