Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSL DDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQ HRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQ SSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGK NIRVKTHLPSWKAGTGRKSVAGLRLEHHHHHH
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 224
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 99% PBS, 0.88% Sodium chloride

General Info

  • Alternative names
    • HKR T1
    • KOX 15
    • KOX15
    • Krox 26 protein
    • KROX26
    • Zfp422
    • Zinc finger protein 22
    • Zinc finger protein 22 (KOX 15)
    • Zinc finger protein KOX15
    • Zinc finger protein Krox 26
    • Zinc finger protein Krox-26
    • ZNF 22
    • ZNF 422
    • Znf22
    • ZNF22_HUMAN
    • ZNF422
    see all
  • Function
    Binds DNA through the consensus sequence 5'-CAATG-3'. May be involved in transcriptional regulation and may play a role in tooth formation.
  • Tissue specificity
    In the embryo, expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, expressed in mesoderm-derived tissues such as skeletal muscle, heart, kidney and liver. Intermediate expression in spleen, thymus and brain. Low levels in endoderm-derived tissues such as intestine and colon.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172167 under non reduced (lane 1) and reduced (lane 2) conditions.

References

ab172167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up