Recombinant Human ZNF276 protein (ab164919)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDTSSSCKAFLLDSALAVKWPRDKETAPRLPQHRGWNPGDAPQTSQGRGT GTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEK QLPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKV SGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYKCPYQGC TAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHT EVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKY HMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEA EPPPGPPSPSVTTEGQAVKPEPT
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW048709
    • D8Ertd370e
    • D8Ertd377e
    • FLJ38685
    • FLJ77809
    • HGNC:23330
    • MGC111410
    • MGC126480
    • MGC45417
    • ZFP276
    • Zinc finger protein (C2H2 type) 276
    • Zinc finger protein 276
    • Zinc finger protein 276 homolog
    • Zinc finger protein 477
    • ZNF477
    see all
  • Relevance
    ZNF276 may be involved in transcriptional regulation.
  • Cellular localization
    Nuclear

Images

  • ab164919 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up