Recombinant Human ZNF312 protein (ab153391)

Overview

  • Product name
    Recombinant Human ZNF312 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP GALEADGSQGKKLLNLCSPLPCMIPLQPLGYEVPSKTLLSYSELWKSSLR AGGGGGGGGGGGGGGGGAPVCGASGLCKTNCGVCCKAELGLAPSALPAGR VIKPQVINQAVGLTASGSLYYFNYLDSTAYPPSELLSGHLFPSGLLNAQA PAALAAHPKLFLLENAKLAGLAADKFPHPAPYPHKERLPAPLEQVLKENW ALTAERGGVKGHSKLPGGSADGKPKNFTCEVCGKVFNAHYNLTRHMPVHT GARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNT HIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQ VYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSA KDLTRTVQS
    • Amino acids
      1 to 459
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fez
    • FEZ family zinc finger protein 2
    • FEZF 2
    • FEZF2
    • FEZL
    • Forebrain embryonic zinc finger like protein 2
    • TOF
    • ZFP 312
    • ZFP312
    • Zinc finger FEZL
    • Zinc finger protein 312
    • Zinc finger protein FEZ like
    • ZNF 312
    see all
  • Relevance
    ZNF312, also known as Fezf2 or Fez-like, is a zinc finger protein that acts as a transcriptional repressor during the development of corticospinal motor neurons and other subcerebral projection neurons. ZNF312 is expressed by early progenitor cells in the ventricular zone. It regulates the fate choice of subcortical projection neurons in the developing cerebral cortex. This protein is expressed in the developing cortical plate during early embryonic development. During late embryonic development and early postnatal development, ZNF312 expression disappears from the cortical progenitors and becomes restricted to the subplate nad the prospective layer V and VI pyramidal neurons.
  • Cellular localization
    Nuclear

Images

  • ab153391 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up