Recombinant Human ZNF330 protein (ab162142)

Overview

  • Product name
    Recombinant Human ZNF330 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPKKKTGARKKAENRREREKQLRASRSTIDLAKHPCNASMECDKCQRRQK NRAFCYFCNSVQKLPICAQCGKTKCMMKSSDCVIKHAGVYSTGLAMVGAI CDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHGGRIFSCSFCH NFLCEDDQFEHQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRS KVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGY DAYWKNLSSDKYGDTSYHDEEEDEYEAEDDEEEEDEGRKDSDTESSDLFT NLNLGRTYASGYAHYEEQEN
    • Amino acids
      1 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • anti-NOA36
    • HSA6591
    • NOA36
    • NOA36 antibody
    • Nucleolar autoantigen 36
    • Nucleolar cysteine rich protein
    • Zinc finger autoantigen 330
    • Zinc finger protein 330
    • ZNF 330
    see all
  • Relevance
    ZNF330 (or NOA 36 - NucleOlar Autoantigen), is a novel human gene. The deduced protein sequence significantly showed nine highly conserved CXXC motifs indicative of several putative zinc fingers. Immunolocalization of the protein in culture of mammalian cells indicates an association with the interphase nucleolus and a transient relocation to the mitotic centromeres and the midbody.
  • Cellular localization
    Nuclear

Images

  • ab162142 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up