Recombinant Human ZNF331 protein (ab163090)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESA YENKSLPTKKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYV NQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAFSRGYQLSQHQ KIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGS SLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGK TFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYE CQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHT GEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVK HERIHTGVKPYGCTECGKSFSHGHQLTQHQKTHSGAKSYECKECGKACNH LNHLREHQRIHNS
    • Amino acids
      1 to 463
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2H2 like zinc finger protein
    • C2H2 like zinc finger protein rearranged in thyroid adenomas
    • C2H2-like zinc finger protein rearranged in thyroid adenomas
    • DKFZp686L0787
    • KRAB zinc finger protein
    • OTTHUMP00000223038
    • OTTHUMP00000223039
    • OTTHUMP00000223040
    • OTTHUMP00000223041
    • OTTHUMP00000223042
    • OTTHUMP00000223043
    • OTTHUMP00000223045
    • OTTHUMP00000223046
    • OTTHUMP00000223047
    • OTTHUMP00000223048
    • OTTHUMP00000223052
    • OTTHUMP00000223053
    • OTTHUMP00000223054
    • RITA
    • Zinc finger protein 331
    • Zinc finger protein 361
    • Zinc finger protein 463
    • ZN331_HUMAN
    • ZNF331
    • ZNF361
    • ZNF463
    see all
  • Function
    May be involved in transcriptional regulation. May play a role in spermatogenesis.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163090 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up