Recombinant Human ZNF350 protein (ab153470)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQ ASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRR KPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYE IKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTR KLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLT EHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSE CGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGER PYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDV MQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDN RGFAQDRNLVNAVNVVVPSVINYVLFYVTENP
    • Amino acids
      1 to 532
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KRAB zinc finger protein ZFQR
    • ZBRK1
    • ZFQR
    • Zinc finger and BRCA1 interacting protein with a KRAB domain 1
    • Zinc finger and BRCA1-interacting protein with a KRAB domain 1
    • Zinc finger protein 350
    • Zinc finger protein ZBRK1
    • ZN350_HUMAN
    • ZNF350
    see all
  • Function
    Transcriptional repressor. Binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus matrix. Associated with the nuclear matrix.
  • Information by UniProt

Images

  • ab153470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up