Recombinant Human ZNF354C protein (ab162323)

Overview

  • Product name
    Recombinant Human ZNF354C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVDLLSAQEPVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSSLVS LGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDI FIEETSQGMVKKESIKDGHWDINFEEAVEFESEIEEEQEKKPLRQMIDSH EKTISEDGNHTSLELGKSLFTNTALVTQQSVPIERIPNMYYTFGKDFKQN FDLMKCFQIYPGGKPHICNECGKSFKQNLHLIEHQRIHTGEKPYKCNECK KTFSHRSSLLSHQRIHTGEKPYKCNECEKAFSNSSTLIKHLRVHTGEKPY RCRECGKAFSQCSTLTVHQRIHTGEKLYKCGECEKAFNCRAKLHRHQRIH TGEKPYKCSECGKGYSQFTSLAEHQRFHTGEQLYTCLECGRTFTRIVTLI EHQRIHTGQKPYQCNECEKAFNQYSSFNEHRKIHTGEKLYTCEECGKAFG CKSNLYRHQRIHTGEKPYQCNQWKGLQPVFIFNRT
    • Amino acids
      1 to 485
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • and developmentally-regulated protein 3
    • hKID3
    • ischemia
    • Kidney
    • KRAB zinc finger protein synten
    • Z354C_HUMAN
    • Zinc finger protein 354C
    • ZNF354C
    see all
  • Function
    May function as a transcription repressor. Suppresses osteogenic effects of RUNX2. Binds to 5'-CCACA-3' core sequence. May be involved in osteoblastic differentiation.
  • Tissue specificity
    Expressed in kidney and skeletal muscle. Very low expression in brain and heart.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 11 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Developmental stage
    Expressed in brain. Very low expression in lung and liver.
  • Domain
    KRAB domain is not required for nuclear targeting or for DNA binding.
    Zinc finger region is involved in nuclear targeting and DNA-binding.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up