Recombinant Human ZNF364 protein (ab162124)

Overview

  • Product name
    Recombinant Human ZNF364 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVT DDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDN RANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFA GFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTG PPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFF HSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHD RWTF
    • Amino acids
      1 to 304
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCA2
    • Breast cancer associated gene 2
    • CL469780
    • E3 ubiquitin-protein ligase RNF115
    • Rabring 7
    • RING finger protein 115
    • RN115_HUMAN
    • RNF115
    • Zinc finger protein 364
    see all
  • Function
    Acts as an E2-dependent E3 ubiquitin-protein ligase. May be involved in endocytic trafficking.
  • Tissue specificity
    Expressed at extremely low levels in normal breast, prostate, lung, colon. Higher levels of expression are detected in heart, skeletal muscle, testis as well as in breast and prostate cancer cells.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    RING-type zinc finger-dependent and E2-dependent autoubiquitination.
  • Cellular localization
    Cytoplasm > cytosol. The GTP-bound form of RAB7A recruits RNF115 from the cytosol onto late endosomes/lysosomes.
  • Information by UniProt

Images

  • ab162124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up