Recombinant Human ZNF365 protein (ab161465)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLE VRAAFVQLTQKKQEVQRRERALN
    • Amino acids
      147 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Em:AC024598.1
    • Em:AC067751.1
    • KIAA0844
    • MGC41821
    • MGC87345
    • protein su48
    • Protein ZNF365
    • SU48
    • Talanin
    • UAN
    • Zinc finger protein 365
    • ZNF365D
    see all
  • Relevance
    Zinc Finger Protein 365 is a new candidate transcription factor.
  • Cellular localization
    Cytoplasm; cytoskeleton; centrosome.

Images

  • ab161465 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up