Recombinant Human ZNF622 protein (ab164828)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQER VRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC108936
    • Zfp622
    • Zinc finger protein 622
    • Zinc finger-like protein 9
    • ZN622_HUMAN
    • ZNF622
    • ZPR9
    see all
  • Function
    May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
  • Tissue specificity
    Expressed in lung, kidney, spleen, liver and brain with lowest expression in kidney.
  • Sequence similarities
    Contains 2 U1-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated by MELK. The phosphorylation may redirect the protein to the nucleus.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab164828 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up