Recombinant Human ZNF650 protein (ab165329)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEF ASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSE DRPTGLVVLL
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434P117
    • DKFZp686N10185
    • E3 ubiquitin-protein ligase UBR3
    • FLJ37422
    • KIAA2024
    • MGC126489
    • N-recognin-3
    • Ubiquitin-protein ligase E3-alpha-3
    • Ubiquitin-protein ligase E3-alpha-III
    • Ubr3
    • UBR3_HUMAN
    • Zinc finger protein 650
    • ZNF 650
    see all
  • Function
    E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the UBR1 family.
    Contains 1 RING-type zinc finger.
    Contains 1 UBR-type zinc finger.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165329 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up