Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKE IPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSD LSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFS QSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRE CGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGER PYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQR IHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSS LIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAF RHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 446
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.02% DTT, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Cos17
    • Zinc finger protein 70
    • Zinc finger protein N27C7-1
    • ZNF70
    • ZNF70_HUMAN
    see all
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 11 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab152057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up