Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPD LITCLEQGKEAWSMKRHEIMVAKPT
    • Amino acids
      2 to 76
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HPF 4
    • HPF4
    • HTF 1
    • HTF1
    • MGC78566
    • Zinc finger protein 85
    • Zinc finger protein HPF4
    • Zinc finger protein HTF1
    • ZNF 85
    • ZNF85
    • ZNF85_HUMAN
    see all
  • Function
    May be a transcriptional repressor.
  • Tissue specificity
    Widely expressed, including in testis.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 16 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159859 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up