Recombinant Human ZNFN1A4 protein (ab163824)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPS RSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDG SGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQ CGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSS PTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDE IRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSL SDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNC ISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGP LTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQPPPTIVVGRHS PAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFLD HVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG
    • Amino acids
      1 to 544
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EOS
    • Eos protein
    • IKAROS family zinc finger 4
    • IKAROS family zinc finger 4 (Eos)
    • Ikaros family zinc finger protein 4
    • IKZF4
    • IKZF4_HUMAN
    • KIAA1782
    • Zinc finger protein Eos
    • Zinc finger protein Eos (IKAROS family zinc finger protein 4)
    • Zinc finger protein, subfamily 1A, 4 (Eos)
    • Zinc finger protein, subfamily 1A, member 4
    • Zinc finger transcription factor Eos
    • ZNFN1A4
    see all
  • Function
    DNA-binding protein that binds to the 5'GGGAATRCC-3' Ikaros-binding sequence. Transcriptional repressor. Interacts with SPI1 and MITF to repress transcription of the CTSK and ACP5 promoters via recruitment of corepressors SIN3A and CTBP2. May be involved in the development of central and peripheral nervous systems.
  • Tissue specificity
    Highly expressed in skeletal muscle, low levels of expression in heart, thymus, kidney, liver, and spleen. Expressed in the hematopoietic cell lines MOLT-4, NALM-6 and K562. Highly expressed in THP-1 and Mo7e-IL3 cell lines, which have characteristics of myeloid and early megakaryocytic cells respectively.
  • Sequence similarities
    Belongs to the Ikaros C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Domain
    The N-terminal zinc fingers are involved in sequence-specific DNA binding and heterotypic associations with other family members.
    C-terminal zinc fingers mediate homodimerization.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163824 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up