Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRAS LADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYN DDVLT
    • Amino acids
      74 to 178
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B830022L21Rik
    • DKFZp434E229
    • E3 ubiquitin protein ligase ZNRF1
    • E3 ubiquitin-protein ligase ZNRF1
    • EC 6.3.2.-
    • FLJ14846
    • MGC101991
    • MGC15430
    • Nerve injury gene 283
    • Nerve injury induced gene 283 protein
    • Nerve injury-induced gene 283 protein
    • NIN283
    • Rnf42
    • Zinc and ring finger 1
    • zinc and ring finger protein 1
    • zinc finger and ring finger protein 1
    • Zinc/RING finger protein 1
    • ZNRF 1
    • znrf1
    • ZNRF1_HUMAN
    • Zrfp1
    see all
  • Function
    E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to substrates. May play a role in the establisment and maintenance of neuronal transmission and plasticity via its ubiquitin-protein ligase activity.
  • Tissue specificity
    Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization
    Endosome. Lysosome. Membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Associated with synaptic vesicle membranes in neurons.
  • Information by UniProt

Images

  • ab164701 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up