Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSGNSIDVSQLVNPAFP GTVTCDEREITVEFPSSPGTKKWHASVVDPLGLDMPNCTYILDPEKLTLR ATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEETQGLS ASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLP EAMKEGFSLLIDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPG QKVIFSSQAICAPDPVTCNATHMTLTIPEFPGKLKSVSFENQNIDVSQLH DNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETV SMVIYPECLCESPVSIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGN SSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPP SKISRDSEFRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPY GENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQW NVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVSEAHVLSS LVYFHCSALICNRLSPDSPLCSVTCPVSSRHRRATGATEAEKMTVSLPGP ILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTA GDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH
    • Amino acids
      1 to 736
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000115849
    • Processed zona pellucida sperm-binding protein 2
    • Zona pellucida glycoprotein 2
    • zona pellucida glycoprotein ZP2
    • Zona pellucida protein A
    • Zp-2
    • ZP2
    • ZP2_HUMAN
    • ZPA
    see all
  • Function
    The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor.
  • Tissue specificity
    Oocytes.
  • Sequence similarities
    Belongs to the ZP domain family. ZPA subfamily.
    Contains 1 ZP domain.
  • Developmental stage
    Expressed during the 2-week growth phase of oogenesis, prior to ovulation.
  • Domain
    The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.
  • Post-translational
    modifications
    Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.
    Proteolytically cleaved in the N-terminal part after fertilization, yielding a N-terminal peptide of about 30 kDa which remains covalently attached to the C-terminal peptide via disulfide bond(s). This cleavage may play an important role in the post-fertilization block to polyspermy.
    O-glycosylated; contains sulfate-substituted glycans.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix and Cell membrane.
  • Information by UniProt

Images

  • ab159886 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up