Recombinant Human ZRANB2 protein (ab152981)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGT EIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERT GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED KESEGEEGDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKSNR RSRSKSGSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSRSSSRERSR SRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKK RRTRSRSPESQVIGENTKQP
    • Amino acids
      1 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ZRANB 2
    • DKFZp686J1831
    • DKFZp686N09117
    • FLJ41119
    • OTTHUMP00000011240
    • OTTHUMP00000011241
    • Zinc finger protein 265
    • Zinc finger RAN binding domain containing 2
    • Zinc finger Ran binding domain containing protein 2
    • Zinc finger splicing
    • ZIS
    • ZIS1
    • ZIS2
    • ZNF265
    see all
  • Relevance
    ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5'-splice site selection.
  • Cellular localization
    Nuclear

Images

  • ab152981 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up