Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEAN RDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG
    • Amino acids
      294 to 393
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCCH type zinc finger
    • CCCH type zinc finger, RNA binding motif and serine/arginine rich protein 2
    • MGC142014
    • MGC142040
    • Renal carcinoma antigen NY REN 20
    • Renal carcinoma antigen NY-REN-20
    • RNA-binding motif and serine/arginine rich protein 2
    • U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit related protein 2
    • U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
    • U2(RNU2) small nuclear RNA auxiliary factor 1 like 2
    • U2(RNU2) small nuclear RNA auxiliary factor 1-like 2
    • U2AF1 RS2
    • U2AF1L2
    • U2AF1RS2
    • U2AF35-related protein
    • U2AFM_HUMAN
    • URP
    • Zinc finger-, CCCH domain-, and RNA-binding motif-containing serine/arginine-rich protein 2
    • Zrsr2
    see all
  • Function
    Pre-mRNA-binding protein required for splicing of both U2- and U12-type introns. Selectively interacts with the 3'-splice site of U2- and U12-type pre-mRNAs and promotes different steps in U2 and U12 intron splicing. Recruited to U12 pre-mRNAs in an ATP-dependent manner and is required for assembly of the prespliceosome, a precursor to other spliceosomal complexes. For U2-type introns, it is selectively and specifically required for the second step of splicing.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 2 C3H1-type zinc fingers.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated in the RS domain by SRPK1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159976 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up