Recombinant Human ZSWIM2 protein (ab165619)

Overview

  • Product name
    Recombinant Human ZSWIM2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPE YMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQL
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase ZSWIM2
    • MEKK1-related protein X
    • MEX
    • MGC33890
    • Zinc finger SWIM domain containing 2
    • Zinc finger SWIM domain containing protein 2
    • Zinc finger SWIM domain-containing protein 2
    • Zinc finger SWIM type containing 2
    • ZSWIM2
    • ZSWM2_HUMAN
    • ZZ type zinc finger containing protein 2
    • ZZ-type zinc finger-containing protein 2
    • ZZZ2
    see all
  • Function
    E3 ubiquitin-protein ligase involved in the regulation of Fas-, DR3- and DR4-mediated apoptosis. Functions in conjunction with the UBE2D1, UBE2D3 and UBE2E1 E2 ubiquitin-conjugating enzymes.
  • Sequence similarities
    Contains 2 RING-type zinc fingers.
    Contains 1 SWIM-type zinc finger.
    Contains 1 ZZ-type zinc finger.
  • Domain
    The SWIM-type zinc finger is reqiered for ubiquitination activity.
  • Post-translational
    modifications
    Polyubiquitinated. Polyubiquitination is followed by degradation via the proteasome.
  • Information by UniProt

Images

  • ab165619 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up