Overview

  • Product name
    Recombinant Human ZU5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQE EPVSQPTPQLENEVSRQHLPATLPEMVAFYQELHTPTQGQTMVRQLMHKL LVFSAREVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVSLILVWDLSDA PSLSQAQGLVSPVVACGPHGASFLKPCTLTFKHCAEQPSHARTYSSNTTL LDAKVWRPLGRPGAHASRDECRIHLSHFSLYTCVLEAPVGREARKWLQLA VFCSPLVPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFDF NGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKA ADENEDCSALTNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVS QPPPCNRLPPELFEQLRMLLEPNSITGNDWRGLASHLGLCGMKIRFLSCQ RSPAAAILELFEEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPG PERGGARDNQGLELDEKL
    • Amino acids
      1 to 518
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC34763
    • OTTHUMP00000016362
    • Protein unc 5 homolog C like
    • Protein unc-5 homolog C-like
    • UN5CL_HUMAN
    • Unc 5 homolog C (C. elegans) like
    • Unc 5 homolog C like
    • UNC5C-like protein
    • UNC5CL
    • ZU5 and death domain containing
    • ZU5 and death domain containing inhibitor of NF- kB
    • ZU5 and death domain containing protein
    • ZU5 and death domain-containing protein
    • ZUD
    see all
  • Function
    Inhibits NF-kappa-B-dependent transcription by impairing NF-kappa-B binding to its targets.
  • Tissue specificity
    Expressed in pancreas, liver and kidney.
  • Sequence similarities
    Belongs to the unc-5 family.
    Contains 1 death domain.
    Contains 1 ZU5 domain.
  • Cellular localization
    Membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab165994 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up