Overview

  • Product name
    Recombinant Human ZW10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFL PSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLE RDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTGAQRLEEAQKCLKLLKS RKCFDLKILKSLSMELTIQKQNILYHLGEEWQKLIVWKFPPSKDTSSLES YLQTELHLYTEQSHKEEKTPMPPISSVLLAFSVLGELHSKLKSFGQMLLK YILRPLASCPSLHAVIESQPNIVIIRFESIMTNLEYPSPSEVFTKIRLVL EVLQKQLLDLPLDTDLENEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYS IPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFA NKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKV SNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTS SDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAH HLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGEL LERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYC KAMGTLLNTAISEVIGKITALEDISTEDGDRLYSLCKTVMDEGPQVFAPL SEESKNKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAA AFSSSEVKALIRALFQNTERRAAALAKIK
    • Molecular weight
      115 kDa including tags
    • Amino acids
      1 to 779

Specifications

Our Abpromise guarantee covers the use of ab132235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Centromere/kinetochore protein zw10
    • Centromere/kinetochore protein zw10 homolog
    • HZW 10
    • HZW10
    • Kinetochore associated homolog
    • KNTC1AP
    • MGC149821
    • Zeste white 10
    • Zeste white 10 homolog
    • ZW 10
    • ZW 10 homolog centromere/kinetochore protein
    • ZW 10 kinetochore associated homolog
    • Zw10
    • ZW10 (Drosophila) homolog centromere/kinetochore protein
    • ZW10 homolog centromere/kinetochore protein
    • ZW10 homolog centromere/kinetochore protein (Drosophila)
    • ZW10 kinetochore associated homolog
    • ZW10, kinetochore associated, homolog (Drosophila)
    • ZW10_HUMAN
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132235.

References

ab132235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up