Recombinant Human ZWILCH protein (ab162946)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITG IVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSAL DDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNH LYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGD STKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQ DLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGT IPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRV QKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPV RPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDF SELTLNGSLEERIFFTNMVTCSQVHFK
    • Amino acids
      1 to 477
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10036
    • FLJ16343
    • homolog of Drosophila Zwilch
    • hZwilch
    • KNTC1AP
    • MGC111034
    • Protein zwilch homolog
    • ZWILC_HUMAN
    • zwilch
    • zwilch kinetochore protein
    • ZWILCH protein
    • Zwilch, kinetochore associated, homolog
    see all
  • Function
    Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores. Its function related to the spindle assembly machinery is proposed to depend on its association in the mitotic RZZ complex (PubMed:15824131).
  • Sequence similarities
    Belongs to the ZWILCH family.
  • Cellular localization
    Chromosome, centromere, kinetochore.
  • Information by UniProt

Images

  • ab162946 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up