Recombinant Human ZYG11BL protein (ab161000)

Overview

  • Product name
    Recombinant Human ZYG11BL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRL VNEYVELVNAACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAI RKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCTNIFYEEENPG GCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNS LAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLRH LDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKM EEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGD KNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITA LKCHKYDRNIQVTGSAALFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQ EVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRQDESIQRIAV HLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQVMEFSWSA LWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAE VKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWG VCEPQREEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQH WATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKV IEHCSNFKEENMDTSR
    • Amino acids
      1 to 766
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9orf60
    • chromosome 9 open reading frame 60
    • homolog of Zyg 11
    • Hzyg
    • Protein zer-1 homolog
    • zer 1 homolog (C elegans)
    • ZER1
    • ZER1_HUMAN
    • ZYG
    • zyg 11 homolog B (C elegans) like
    • Zyg 11 homolog B like protein
    • ZYG homolog
    • Zyg-11 homolog B-like protein
    see all
  • Function
    Probably acts as target recruitment subunit in the E3 ubiquitin ligase complex ZER1-CUL2-Elongin BC.
  • Tissue specificity
    Expressed in testis, spermatocytes and spermatids (at protein level). Expressed in spermatocytes, spermatids, prostate, skeletal muscle, ovary, small intestine, heart, brain and pancreas.
  • Sequence similarities
    Belongs to the zyg-11 family.
    Contains 5 ARM repeats.
    Contains 3 LRR (leucine-rich) repeats.
  • Information by UniProt

Images

  • ab161000 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up