Overview

  • Product name
    Recombinant Human ZZZ3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIDLWLYSYQRLLQTIAVLEAQRSQAVQDLESLGRHQREALKNPIGFVEK LQKKADIGLPYPQRVVQLPEIVWDQYTHSLGNFEREFKNRKRHTRRVKLV FGKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEGSSSRPQMIRGRLCD DTKPETFNQLWTVEEQKKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQ VASQVQKYFIKLTKAGIPVPGRTPNLCIYSKKSSTSRRQHPLNKHLFKPS TFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMYRNLPEYKE LLQFKKLKKQKLQQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPE MSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYL DPNYFPANR
    • Amino acids
      1 to 409
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATAC component 1 homolog
    • ATAC1
    • DKFZp313N0119
    • DKFZp564I052
    • FLJ10362
    • Zinc finger ZZ domain containing 3
    • Zinc finger ZZ type containing 3
    • ZZ type zinc finger containing protein 3
    • ZZ-type zinc finger-containing protein 3
    • ZZZ 3
    • ZZZ3
    • ZZZ3_HUMAN
    see all
  • Function
    Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Sequence similarities
    Contains 1 HTH myb-type DNA-binding domain.
    Contains 1 ZZ-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161868 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up