Recombinant Influenza A Hemagglutin HA1 protein (ab124542)

Overview

  • Product name
    Recombinant Influenza A Hemagglutin HA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected BTI-TN-5B1-4 cells
  • Amino Acid Sequence
    • Accession
    • Sequence
      ADPMDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDG VKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPANDLCYPGNFN DYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGVPSFFRN VVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDAAEQTKLYQNPTT YISVGTSTLNQRLVPKIATRSKVNGQSGRMDFFWTILKPNDAINFESNGN FIAPEYAYKIVKKGDSAIMKSEVEYGNCNTKCQTPIGAINSSMPFHNIHP LTIGECPKYVKSNKLVLATGLRNSPLHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      17 to 338
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab124542 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

Recombinant Influenza A Hemagglutin HA1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124542.

References for Recombinant Influenza A Hemagglutin HA1 protein (ab124542)

ab124542 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up