Overview

  • Product nameRecombinant Intein CBD protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SequenceMKIEEGKLVIGSLEGCFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPR EVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRT PRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEG PERANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYE NDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSL MERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRGASTNPGVSAWQV NTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQGGHGGIRNN LNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRETFLAGLIDSDGYV TDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVTKHKI SYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKED DYYGITLSDDSDHQFLLGSQVVVQNLEHHHHHH
    • Molecular weight59 kDa including tags
    • Amino acids3 to 518
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113591 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

Recombinant Intein CBD protein images

  • 15% SDS-PAGE analysis of ab113591 (3µg)

References for Recombinant Intein CBD protein (ab113591)

ab113591 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"